Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1274409..1275136 | Replicon | chromosome |
Accession | NZ_CP097884 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | NAG72_RS06115 | Protein ID | WP_000550189.1 |
Coordinates | 1274409..1274723 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NAG72_RS06120 | Protein ID | WP_000560266.1 |
Coordinates | 1274720..1275136 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG72_RS06095 (1270567) | 1270567..1271553 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
NAG72_RS06100 (1271632) | 1271632..1272324 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
NAG72_RS06105 (1272401) | 1272401..1272904 | - | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
NAG72_RS06110 (1272989) | 1272989..1274125 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NAG72_RS06115 (1274409) | 1274409..1274723 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
NAG72_RS06120 (1274720) | 1274720..1275136 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
NAG72_RS06125 (1275181) | 1275181..1277199 | - | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NAG72_RS06130 (1277625) | 1277625..1279976 | - | 2352 | WP_000695487.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T246488 WP_000550189.1 NZ_CP097884:1274409-1274723 [Escherichia coli str. K-12 substr. MG1655]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT246488 WP_000560266.1 NZ_CP097884:1274720-1275136 [Escherichia coli str. K-12 substr. MG1655]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|