Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 3977783..3978195 | Replicon | chromosome |
Accession | NZ_CP097882 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | NAG70_RS19480 | Protein ID | WP_000132601.1 |
Coordinates | 3977854..3978195 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 3977783..3977859 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG70_RS19470 (3974646) | 3974646..3976235 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
NAG70_RS19475 (3976232) | 3976232..3977626 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3977783) | 3977783..3977859 | - | 77 | NuclAT_15 | - | Antitoxin |
NAG70_RS19480 (3977854) | 3977854..3978195 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
NAG70_RS19485 (3978357) | 3978357..3979736 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
NAG70_RS19490 (3979736) | 3979736..3980782 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T246454 WP_000132601.1 NZ_CP097882:3977854-3978195 [Escherichia coli str. K-12 substr. MG1655]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT246454 NZ_CP097882:c3977859-3977783 [Escherichia coli str. K-12 substr. MG1655]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|