Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 3669541..3670082 | Replicon | chromosome |
Accession | NZ_CP097882 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | Q47149 |
Locus tag | NAG70_RS18040 | Protein ID | WP_000615983.1 |
Coordinates | 3669804..3670082 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | Q47150 |
Locus tag | NAG70_RS18035 | Protein ID | WP_000729703.1 |
Coordinates | 3669541..3669801 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG70_RS18015 (3665216) | 3665216..3666001 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NAG70_RS18020 (3665973) | 3665973..3667685 | + | 1713 | Protein_3521 | flagellar biosynthesis protein FlhA | - |
NAG70_RS18025 (3667909) | 3667909..3668406 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
NAG70_RS18030 (3668582) | 3668582..3669331 | - | 750 | WP_000056849.1 | C40 family peptidase | - |
NAG70_RS18035 (3669541) | 3669541..3669801 | + | 261 | WP_000729703.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
NAG70_RS18040 (3669804) | 3669804..3670082 | + | 279 | WP_000615983.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
NAG70_RS18045 (3670238) | 3670238..3670978 | + | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
NAG70_RS18050 (3670949) | 3670949..3671716 | - | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
NAG70_RS18055 (3671922) | 3671922..3672500 | - | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10846.62 Da Isoelectric Point: 9.9941
>T246453 WP_000615983.1 NZ_CP097882:3669804-3670082 [Escherichia coli str. K-12 substr. MG1655]
MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4Q2U |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4Q2U | |
AlphaFold DB | A0A5F1F716 |