Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 1779061..1779563 | Replicon | chromosome |
| Accession | NZ_CP097882 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | U9YDH0 |
| Locus tag | NAG70_RS08440 | Protein ID | WP_000767829.1 |
| Coordinates | 1779309..1779563 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | S1Q063 |
| Locus tag | NAG70_RS08435 | Protein ID | WP_001259255.1 |
| Coordinates | 1779061..1779312 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG70_RS08410 (1774239) | 1774239..1775306 | - | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
| NAG70_RS08415 (1775306) | 1775306..1776376 | - | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
| NAG70_RS08420 (1776373) | 1776373..1777677 | - | 1305 | WP_000009594.1 | histidinol dehydrogenase | - |
| NAG70_RS08425 (1777683) | 1777683..1778582 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| NAG70_RS08430 (1778728) | 1778728..1778778 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
| NAG70_RS08435 (1779061) | 1779061..1779312 | + | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| NAG70_RS08440 (1779309) | 1779309..1779563 | + | 255 | WP_000767829.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| NAG70_RS08445 (1779646) | 1779646..1780470 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| NAG70_RS08450 (1780516) | 1780516..1781445 | + | 930 | WP_000803351.1 | LysR substrate-binding domain-containing protein | - |
| NAG70_RS08455 (1781660) | 1781660..1781722 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
| NAG70_RS08460 (1781712) | 1781712..1783070 | + | 1359 | WP_000019197.1 | putrescine/proton symporter PlaP | - |
| NAG70_RS08465 (1783249) | 1783249..1784307 | + | 1059 | WP_000492339.1 | thiosulfate utilization transporter TsuA/YeeE | - |
| NAG70_RS08470 (1784321) | 1784321..1784548 | + | 228 | WP_000234896.1 | sulfurtransferase TusA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T246441 WP_000767829.1 NZ_CP097882:1779309-1779563 [Escherichia coli str. K-12 substr. MG1655]
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|