Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 183528..183750 | Replicon | chromosome |
| Accession | NZ_CP097882 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | NAG70_RS00880 | Protein ID | WP_000141634.1 |
| Coordinates | 183643..183750 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 183528..183594 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG70_RS00860 | 178969..179871 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| NAG70_RS00865 | 179882..180865 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| NAG70_RS00870 | 180862..181866 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| NAG70_RS00875 | 181896..183167 | - | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
| - | 183528..183594 | - | 67 | - | - | Antitoxin |
| NAG70_RS00880 | 183643..183750 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| NAG70_RS00885 | 183837..185516 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| NAG70_RS00890 | 185513..185704 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| NAG70_RS00895 | 185701..187272 | - | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NAG70_RS00900 | 187545..187733 | + | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
| NAG70_RS00905 | 187769..188497 | + | 729 | WP_011310329.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T246433 WP_000141634.1 NZ_CP097882:183643-183750 [Escherichia coli str. K-12 substr. MG1655]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT246433 NZ_CP097882:c183594-183528 [Escherichia coli str. K-12 substr. MG1655]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|