Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
Location | 3906984..3907396 | Replicon | chromosome |
Accession | NZ_CP097881 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | NAG69_RS19010 | Protein ID | WP_000132601.1 |
Coordinates | 3907055..3907396 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3906984..3907060 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG69_RS19000 (3903847) | 3903847..3905436 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
NAG69_RS19005 (3905433) | 3905433..3906827 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_13 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_13 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_13 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_13 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3906984) | 3906984..3907060 | - | 77 | NuclAT_14 | - | Antitoxin |
NAG69_RS19010 (3907055) | 3907055..3907396 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
NAG69_RS19015 (3907558) | 3907558..3908937 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
NAG69_RS19020 (3908937) | 3908937..3909983 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T246428 WP_000132601.1 NZ_CP097881:3907055-3907396 [Escherichia coli str. K-12 substr. MG1655]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT246428 NZ_CP097881:c3907060-3906984 [Escherichia coli str. K-12 substr. MG1655]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|