Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 3598742..3599283 | Replicon | chromosome |
Accession | NZ_CP097881 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | Q47149 |
Locus tag | NAG69_RS17570 | Protein ID | WP_000615983.1 |
Coordinates | 3599005..3599283 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | Q47150 |
Locus tag | NAG69_RS17565 | Protein ID | WP_000729703.1 |
Coordinates | 3598742..3599002 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG69_RS17545 (3594417) | 3594417..3595202 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NAG69_RS17550 (3595174) | 3595174..3596886 | + | 1713 | Protein_3427 | flagellar biosynthesis protein FlhA | - |
NAG69_RS17555 (3597110) | 3597110..3597607 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
NAG69_RS17560 (3597783) | 3597783..3598532 | - | 750 | WP_000056849.1 | C40 family peptidase | - |
NAG69_RS17565 (3598742) | 3598742..3599002 | + | 261 | WP_000729703.1 | type II toxin-antitoxin system antitoxin DinJ | Antitoxin |
NAG69_RS17570 (3599005) | 3599005..3599283 | + | 279 | WP_000615983.1 | type II toxin-antitoxin system mRNA interferase toxin YafQ | Toxin |
NAG69_RS17575 (3599439) | 3599439..3600179 | + | 741 | WP_001225679.1 | peptidoglycan meso-diaminopimelic acid protein amidase | - |
NAG69_RS17580 (3600150) | 3600150..3600917 | - | 768 | WP_000333380.1 | class II glutamine amidotransferase | - |
NAG69_RS17585 (3601123) | 3601123..3601701 | - | 579 | WP_000284050.1 | D-sedoheptulose 7-phosphate isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10846.62 Da Isoelectric Point: 9.9941
>T246427 WP_000615983.1 NZ_CP097881:3599005-3599283 [Escherichia coli str. K-12 substr. MG1655]
MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLR
FERTGTHAALFG
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4Q2U |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4Q2U | |
AlphaFold DB | A0A5F1F716 |