Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3592545..3593239 | Replicon | chromosome |
Accession | NZ_CP097881 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NAG69_RS17530 | Protein ID | WP_001263489.1 |
Coordinates | 3592545..3592943 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NAG69_RS17535 | Protein ID | WP_000554758.1 |
Coordinates | 3592946..3593239 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3588133) | 3588133..3588213 | - | 81 | NuclAT_11 | - | - |
- (3588133) | 3588133..3588213 | - | 81 | NuclAT_11 | - | - |
- (3588133) | 3588133..3588213 | - | 81 | NuclAT_11 | - | - |
- (3588133) | 3588133..3588213 | - | 81 | NuclAT_11 | - | - |
NAG69_RS17505 (3588809) | 3588809..3589267 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NAG69_RS17510 (3589528) | 3589528..3590985 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NAG69_RS17515 (3591042) | 3591042..3591563 | - | 522 | Protein_3420 | peptide chain release factor H | - |
NAG69_RS17520 (3591559) | 3591559..3591765 | - | 207 | Protein_3421 | RtcB family protein | - |
NAG69_RS17525 (3592083) | 3592083..3592535 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NAG69_RS17530 (3592545) | 3592545..3592943 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NAG69_RS17535 (3592946) | 3592946..3593239 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NAG69_RS17540 (3593291) | 3593291..3594346 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NAG69_RS17545 (3594417) | 3594417..3595202 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NAG69_RS17550 (3595174) | 3595174..3596886 | + | 1713 | Protein_3427 | flagellar biosynthesis protein FlhA | - |
NAG69_RS17555 (3597110) | 3597110..3597607 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T246426 WP_001263489.1 NZ_CP097881:c3592943-3592545 [Escherichia coli str. K-12 substr. MG1655]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 11233.76 Da Isoelectric Point: 5.2170
>AT246426 WP_000554758.1 NZ_CP097881:c3593239-3592946 [Escherichia coli str. K-12 substr. MG1655]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |