Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1794014..1794516 | Replicon | chromosome |
Accession | NZ_CP097881 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | U9YDH0 |
Locus tag | NAG69_RS08530 | Protein ID | WP_000767829.1 |
Coordinates | 1794262..1794516 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | S1Q063 |
Locus tag | NAG69_RS08525 | Protein ID | WP_001259255.1 |
Coordinates | 1794014..1794265 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG69_RS08500 (1789192) | 1789192..1790259 | - | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
NAG69_RS08505 (1790259) | 1790259..1791329 | - | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
NAG69_RS08510 (1791326) | 1791326..1792630 | - | 1305 | WP_000009594.1 | histidinol dehydrogenase | - |
NAG69_RS08515 (1792636) | 1792636..1793535 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
NAG69_RS08520 (1793681) | 1793681..1793731 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
NAG69_RS08525 (1794014) | 1794014..1794265 | + | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
NAG69_RS08530 (1794262) | 1794262..1794516 | + | 255 | WP_000767829.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
NAG69_RS08535 (1794599) | 1794599..1795423 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
NAG69_RS08540 (1795469) | 1795469..1796398 | + | 930 | WP_000803351.1 | LysR substrate-binding domain-containing protein | - |
NAG69_RS08545 (1796613) | 1796613..1796675 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
NAG69_RS08550 (1796665) | 1796665..1798023 | + | 1359 | WP_000019197.1 | putrescine/proton symporter PlaP | - |
NAG69_RS08555 (1798202) | 1798202..1799260 | + | 1059 | WP_000492339.1 | thiosulfate utilization transporter TsuA/YeeE | - |
NAG69_RS08560 (1799274) | 1799274..1799501 | + | 228 | WP_000234896.1 | sulfurtransferase TusA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T246415 WP_000767829.1 NZ_CP097881:1794262-1794516 [Escherichia coli str. K-12 substr. MG1655]
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|