Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3032539..3033137 | Replicon | chromosome |
| Accession | NZ_CP097858 | ||
| Organism | Vibrio owensii strain GL-605 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7Z7VLH5 |
| Locus tag | M8C01_RS13950 | Protein ID | WP_054103799.1 |
| Coordinates | 3032539..3032862 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A7Z7VJV6 |
| Locus tag | M8C01_RS13955 | Protein ID | WP_054103798.1 |
| Coordinates | 3032859..3033137 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8C01_RS13915 | 3027705..3028211 | + | 507 | WP_023584043.1 | GNAT family N-acetyltransferase | - |
| M8C01_RS13920 | 3028252..3028638 | - | 387 | WP_023584042.1 | TraA family conjugative transfer protein | - |
| M8C01_RS13925 | 3028635..3029207 | - | 573 | WP_001944091.1 | type IV conjugative transfer system lipoprotein TraV | - |
| M8C01_RS13930 | 3029282..3030571 | - | 1290 | WP_086597841.1 | TraB/VirB10 family protein | - |
| M8C01_RS13935 | 3030574..3031470 | - | 897 | WP_086597854.1 | type-F conjugative transfer system secretin TraK | - |
| M8C01_RS13940 | 3031454..3032080 | - | 627 | WP_000667170.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| M8C01_RS13945 | 3032077..3032358 | - | 282 | WP_000433889.1 | type IV conjugative transfer system protein TraL | - |
| M8C01_RS13950 | 3032539..3032862 | + | 324 | WP_054103799.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8C01_RS13955 | 3032859..3033137 | + | 279 | WP_054103798.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M8C01_RS13960 | 3033163..3033798 | - | 636 | WP_029627967.1 | DUF4400 domain-containing protein | - |
| M8C01_RS13965 | 3033785..3034345 | - | 561 | WP_122067048.1 | conjugative transfer protein | - |
| M8C01_RS13970 | 3034355..3036175 | - | 1821 | WP_122067047.1 | conjugative transfer system coupling protein TraD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | sul2 / aph(3'')-Ib / aph(6)-Id / tet(59) | - | 3002833..3073041 | 70208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12295.35 Da Isoelectric Point: 9.7658
>T246393 WP_054103799.1 NZ_CP097858:3032539-3032862 [Vibrio owensii]
MSWKIDFYDGVEEQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
MSWKIDFYDGVEEQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z7VLH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z7VJV6 |