Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 6654707..6655302 | Replicon | chromosome |
Accession | NZ_CP097857 | ||
Organism | Pseudomonas sp. B111 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9E8L6K5 |
Locus tag | M6E97_RS31005 | Protein ID | WP_071534386.1 |
Coordinates | 6655024..6655302 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M6E97_RS31000 | Protein ID | WP_003133769.1 |
Coordinates | 6654707..6655012 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6E97_RS30965 (M6E97_30925) | 6650653..6650943 | - | 291 | WP_023119949.1 | DUF5447 family protein | - |
M6E97_RS30970 (M6E97_30930) | 6650947..6651129 | - | 183 | WP_058187913.1 | hypothetical protein | - |
M6E97_RS30975 (M6E97_30935) | 6651119..6651391 | - | 273 | WP_004352675.1 | hypothetical protein | - |
M6E97_RS30980 (M6E97_30940) | 6651501..6651767 | + | 267 | WP_023088595.1 | hypothetical protein | - |
M6E97_RS30985 (M6E97_30945) | 6651823..6652158 | + | 336 | WP_031637200.1 | hypothetical protein | - |
M6E97_RS30990 (M6E97_30950) | 6652311..6653528 | + | 1218 | WP_071534385.1 | AAA family ATPase | - |
M6E97_RS30995 (M6E97_30955) | 6653529..6654257 | + | 729 | WP_152904799.1 | hypothetical protein | - |
M6E97_RS31000 (M6E97_30960) | 6654707..6655012 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
M6E97_RS31005 (M6E97_30965) | 6655024..6655302 | - | 279 | WP_071534386.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M6E97_RS31010 (M6E97_30970) | 6655355..6655477 | - | 123 | Protein_6131 | integrase | - |
M6E97_RS31015 (M6E97_30975) | 6655625..6657853 | + | 2229 | WP_034005476.1 | TonB-dependent receptor | - |
M6E97_RS31020 (M6E97_30980) | 6657923..6658570 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
M6E97_RS31025 (M6E97_30985) | 6658632..6659870 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10698.23 Da Isoelectric Point: 7.9184
>T246391 WP_071534386.1 NZ_CP097857:c6655302-6655024 [Pseudomonas sp. B111]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMHHAATELRDLRSPPGNRLEPLQGKRVGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|