Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4475120..4475814 | Replicon | chromosome |
Accession | NZ_CP097840 | ||
Organism | Shigella flexneri strain A |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | M9382_RS22530 | Protein ID | WP_001263491.1 |
Coordinates | 4475416..4475814 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | Q0T7Q4 |
Locus tag | M9382_RS22525 | Protein ID | WP_000554759.1 |
Coordinates | 4475120..4475413 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9382_RS22505 (4470759) | 4470759..4471256 | + | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
M9382_RS22510 (4471473) | 4471473..4473185 | - | 1713 | Protein_4381 | flagellar biosynthesis protein FlhA | - |
M9382_RS22515 (4473157) | 4473157..4473942 | + | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
M9382_RS22520 (4474013) | 4474013..4475068 | + | 1056 | WP_001226172.1 | DNA polymerase IV | - |
M9382_RS22525 (4475120) | 4475120..4475413 | + | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M9382_RS22530 (4475416) | 4475416..4475814 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M9382_RS22535 (4475824) | 4475824..4476276 | + | 453 | WP_001059846.1 | GNAT family N-acetyltransferase | - |
M9382_RS22540 (4476522) | 4476522..4477565 | + | 1044 | WP_005060486.1 | RNA ligase RtcB family protein | - |
M9382_RS22545 (4477627) | 4477627..4478241 | + | 615 | Protein_4388 | peptide chain release factor H | - |
M9382_RS22550 (4478298) | 4478298..4479755 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
M9382_RS22555 (4480017) | 4480017..4480475 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T246374 WP_001263491.1 NZ_CP097840:4475416-4475814 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TR46 |