Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4393124..4393968 | Replicon | chromosome |
Accession | NZ_CP097840 | ||
Organism | Shigella flexneri strain A |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A4P7TPN5 |
Locus tag | M9382_RS22105 | Protein ID | WP_005060796.1 |
Coordinates | 4393570..4393968 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | M9382_RS22100 | Protein ID | WP_005053053.1 |
Coordinates | 4393124..4393435 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9382_RS22075 (4388594) | 4388594..4389091 | + | 498 | Protein_4294 | COX aromatic rich motif-containing protein | - |
M9382_RS22080 (4389113) | 4389113..4391104 | + | 1992 | Protein_4295 | cytochrome o ubiquinol oxidase subunit I | - |
M9382_RS22085 (4391094) | 4391094..4391708 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M9382_RS22090 (4391708) | 4391708..4392037 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M9382_RS22095 (4392049) | 4392049..4392939 | + | 891 | WP_000971356.1 | heme o synthase | - |
M9382_RS22100 (4393124) | 4393124..4393435 | + | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
M9382_RS22105 (4393570) | 4393570..4393968 | + | 399 | WP_005060796.1 | GNAT family N-acetyltransferase | Toxin |
M9382_RS22115 (4394864) | 4394864..4397017 | + | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
M9382_RS22120 (4397070) | 4397070..4398800 | + | 1731 | WP_000645011.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4394016..4394519 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14335.69 Da Isoelectric Point: 9.1674
>T246373 WP_005060796.1 NZ_CP097840:4393570-4393968 [Shigella flexneri]
VRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKK
IHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
VRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKK
IHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A5H0K0 |