Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4356168..4356786 | Replicon | chromosome |
Accession | NZ_CP097840 | ||
Organism | Shigella flexneri strain A |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M9382_RS21910 | Protein ID | WP_001291435.1 |
Coordinates | 4356568..4356786 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q0T7C3 |
Locus tag | M9382_RS21905 | Protein ID | WP_000344797.1 |
Coordinates | 4356168..4356542 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9382_RS21895 (4351257) | 4351257..4352450 | + | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M9382_RS21900 (4352473) | 4352473..4355622 | + | 3150 | WP_001132485.1 | efflux RND transporter permease AcrB | - |
M9382_RS21905 (4356168) | 4356168..4356542 | + | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
M9382_RS21910 (4356568) | 4356568..4356786 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M9382_RS21915 (4356958) | 4356958..4357509 | + | 552 | WP_000102577.1 | maltose O-acetyltransferase | - |
M9382_RS21920 (4357625) | 4357625..4358095 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M9382_RS21925 (4358259) | 4358259..4359809 | + | 1551 | WP_005106783.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M9382_RS21930 (4359851) | 4359851..4360204 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M9382_RS21940 (4360583) | 4360583..4360894 | + | 312 | WP_000409911.1 | MGMT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4360924..4362252 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246372 WP_001291435.1 NZ_CP097840:4356568-4356786 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT246372 WP_000344797.1 NZ_CP097840:4356168-4356542 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPD8 |