Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 4053913..4054441 Replicon chromosome
Accession NZ_CP097840
Organism Shigella flexneri strain A

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M9382_RS20300 Protein ID WP_005061113.1
Coordinates 4053913..4054143 (+) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID Q32DW6
Locus tag M9382_RS20305 Protein ID WP_000147081.1
Coordinates 4054133..4054441 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9382_RS20260 (4048981) 4048981..4049181 - 201 WP_000111769.1 protein ninH -
M9382_RS20265 (4049276) 4049276..4049533 - 258 WP_001064799.1 hypothetical protein -
M9382_RS20270 (4049530) 4049530..4050921 - 1392 WP_000211324.1 replicative DNA helicase -
M9382_RS20275 (4050918) 4050918..4051796 - 879 WP_000988183.1 ATP-binding protein -
M9382_RS20280 (4051807) 4051807..4052715 - 909 WP_001247840.1 hypothetical protein -
M9382_RS20285 (4052702) 4052702..4052935 - 234 WP_000618004.1 hypothetical protein -
M9382_RS20290 (4052932) 4052932..4053384 - 453 WP_232046050.1 Rha family transcriptional regulator -
M9382_RS20295 (4053442) 4053442..4053900 - 459 WP_000961311.1 ash family protein -
M9382_RS20300 (4053913) 4053913..4054143 + 231 WP_005061113.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9382_RS20305 (4054133) 4054133..4054441 + 309 WP_000147081.1 helix-turn-helix transcriptional regulator Antitoxin
M9382_RS20310 (4054483) 4054483..4054659 - 177 WP_001252556.1 NinE family protein -
M9382_RS20315 (4054656) 4054656..4055066 - 411 WP_000814621.1 recombination protein NinB -
M9382_RS20320 (4055063) 4055063..4055341 - 279 WP_005061104.1 hypothetical protein -
M9382_RS20325 (4055416) 4055416..4055610 - 195 Protein_3961 hypothetical protein -
M9382_RS20330 (4055680) 4055680..4056848 + 1169 WP_000747032.1 IS3-like element IS911 family transposase -
M9382_RS20335 (4056978) 4056978..4058107 + 1130 WP_112361761.1 IS3-like element ISSfl10 family transposase -
M9382_RS20340 (4058151) 4058151..4058240 - 90 Protein_3964 phage holin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH4.5 4016148..4122850 106702


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8665.12 Da        Isoelectric Point: 10.5308

>T246371 WP_005061113.1 NZ_CP097840:4053913-4054143 [Shigella flexneri]
MKVYGSNLGEPHTSAFGDGLFELRIKGNDGIARVFYCTLTGKRIIMLHSFVKKAQKTPPAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11185.94 Da        Isoelectric Point: 8.5840

>AT246371 WP_000147081.1 NZ_CP097840:4054133-4054441 [Shigella flexneri]
MTGKRTLPTMTHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGISG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7TJC1

References