Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3386004..3386229 | Replicon | chromosome |
| Accession | NZ_CP097840 | ||
| Organism | Shigella flexneri strain A | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | M9382_RS16835 | Protein ID | WP_000813254.1 |
| Coordinates | 3386004..3386159 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3386171..3386229 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9382_RS16800 | 3381130..3381690 | - | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
| M9382_RS16810 | 3382901..3383086 | - | 186 | WP_005049799.1 | hypothetical protein | - |
| M9382_RS16815 | 3383227..3383781 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| M9382_RS16820 | 3383778..3384068 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| M9382_RS16825 | 3384068..3384667 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| M9382_RS16830 | 3384801..3385498 | + | 698 | WP_227804319.1 | IS1 family transposase | - |
| M9382_RS16835 | 3386004..3386159 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3386171..3386229 | + | 59 | - | - | Antitoxin |
| M9382_RS16840 | 3386614..3386979 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| M9382_RS16845 | 3386979..3387644 | - | 666 | WP_000208062.1 | hypothetical protein | - |
| M9382_RS16850 | 3387641..3388006 | - | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
| M9382_RS16855 | 3388008..3388226 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
| M9382_RS16860 | 3388319..3388675 | - | 357 | WP_005048249.1 | hypothetical protein | - |
| M9382_RS16865 | 3388733..3389155 | - | 423 | WP_001118167.1 | DUF977 family protein | - |
| M9382_RS16870 | 3389170..3389913 | - | 744 | WP_000788999.1 | ATP-binding protein | - |
| M9382_RS16875 | 3390059..3390228 | - | 170 | Protein_3281 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 3336626..3396795 | 60169 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T246370 WP_000813254.1 NZ_CP097840:c3386159-3386004 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT246370 NZ_CP097840:3386171-3386229 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|