Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 3386004..3386229 Replicon chromosome
Accession NZ_CP097840
Organism Shigella flexneri strain A

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9382_RS16835 Protein ID WP_000813254.1
Coordinates 3386004..3386159 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 3386171..3386229 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9382_RS16800 3381130..3381690 - 561 WP_072075205.1 ORF6N domain-containing protein -
M9382_RS16810 3382901..3383086 - 186 WP_005049799.1 hypothetical protein -
M9382_RS16815 3383227..3383781 - 555 WP_000640143.1 DUF1133 family protein -
M9382_RS16820 3383778..3384068 - 291 WP_000228038.1 DUF1364 domain-containing protein -
M9382_RS16825 3384068..3384667 - 600 WP_000940329.1 DUF1367 family protein -
M9382_RS16830 3384801..3385498 + 698 WP_227804319.1 IS1 family transposase -
M9382_RS16835 3386004..3386159 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 3386171..3386229 + 59 - - Antitoxin
M9382_RS16840 3386614..3386979 - 366 WP_000610655.1 DUF551 domain-containing protein -
M9382_RS16845 3386979..3387644 - 666 WP_000208062.1 hypothetical protein -
M9382_RS16850 3387641..3388006 - 366 WP_001229298.1 HNH endonuclease signature motif containing protein -
M9382_RS16855 3388008..3388226 - 219 WP_000256998.1 DUF4014 family protein -
M9382_RS16860 3388319..3388675 - 357 WP_005048249.1 hypothetical protein -
M9382_RS16865 3388733..3389155 - 423 WP_001118167.1 DUF977 family protein -
M9382_RS16870 3389170..3389913 - 744 WP_000788999.1 ATP-binding protein -
M9382_RS16875 3390059..3390228 - 170 Protein_3281 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage sitABCD ipaH9.8 3336626..3396795 60169


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246370 WP_000813254.1 NZ_CP097840:c3386159-3386004 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246370 NZ_CP097840:3386171-3386229 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References