Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1596146..1596873 | Replicon | chromosome |
Accession | NZ_CP097840 | ||
Organism | Shigella flexneri strain A |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | M9382_RS07715 | Protein ID | WP_000550189.1 |
Coordinates | 1596146..1596460 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M9382_RS07720 | Protein ID | WP_000560266.1 |
Coordinates | 1596457..1596873 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9382_RS07695 (1592295) | 1592295..1593293 | - | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
M9382_RS07700 (1593372) | 1593372..1594064 | - | 693 | WP_000942537.1 | vancomycin high temperature exclusion protein | - |
M9382_RS07705 (1594137) | 1594137..1594640 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
M9382_RS07710 (1594725) | 1594725..1595861 | + | 1137 | WP_000018658.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
M9382_RS07715 (1596146) | 1596146..1596460 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
M9382_RS07720 (1596457) | 1596457..1596873 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
M9382_RS07725 (1596918) | 1596918..1598936 | - | 2019 | WP_000121486.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
M9382_RS07730 (1599162) | 1599162..1601513 | - | 2352 | WP_000695506.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T246362 WP_000550189.1 NZ_CP097840:1596146-1596460 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT246362 WP_000560266.1 NZ_CP097840:1596457-1596873 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|