Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1154581..1154803 | Replicon | chromosome |
| Accession | NZ_CP097840 | ||
| Organism | Shigella flexneri strain A | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | M9382_RS05450 | Protein ID | WP_001295224.1 |
| Coordinates | 1154696..1154803 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1154581..1154647 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9382_RS05430 | 1150022..1150924 | + | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
| M9382_RS05435 | 1150935..1151918 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| M9382_RS05440 | 1151915..1152919 | + | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| M9382_RS05445 | 1152949..1154220 | - | 1272 | WP_005052340.1 | aromatic amino acid transport family protein | - |
| - | 1154581..1154647 | - | 67 | - | - | Antitoxin |
| M9382_RS05450 | 1154696..1154803 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1155065..1155122 | - | 58 | NuclAT_23 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_23 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_23 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_23 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_25 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_25 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_25 | - | - |
| - | 1155065..1155122 | - | 58 | NuclAT_25 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_27 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_27 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_27 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_27 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_29 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_29 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_29 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_29 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_31 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_31 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_31 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_31 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_33 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_33 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_33 | - | - |
| - | 1155067..1155122 | - | 56 | NuclAT_33 | - | - |
| M9382_RS05455 | 1155179..1155286 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1155548..1155605 | - | 58 | NuclAT_22 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_22 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_22 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_22 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_24 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_24 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_24 | - | - |
| - | 1155548..1155605 | - | 58 | NuclAT_24 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_26 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_26 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_26 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_26 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_28 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_28 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_28 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_28 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_30 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_30 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_30 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_30 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_32 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_32 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_32 | - | - |
| - | 1155550..1155605 | - | 56 | NuclAT_32 | - | - |
| M9382_RS05460 | 1155662..1155769 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| M9382_RS05465 | 1155856..1157535 | - | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| M9382_RS05470 | 1157532..1157723 | - | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| M9382_RS05475 | 1157720..1159291 | - | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| M9382_RS05480 | 1159564..1159752 | + | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T246360 WP_001295224.1 NZ_CP097840:1154696-1154803 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT246360 NZ_CP097840:c1154647-1154581 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
