Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2565172..2565397 | Replicon | chromosome |
| Accession | NZ_CP097837 | ||
| Organism | Shigella flexneri strain B | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | M9380_RS13190 | Protein ID | WP_000813254.1 |
| Coordinates | 2565172..2565327 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2565339..2565397 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9380_RS13135 | 2560484..2560834 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M9380_RS13140 | 2560831..2561505 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| M9380_RS13145 | 2561604..2561819 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| M9380_RS13170 | 2562615..2563303 | - | 689 | Protein_2554 | bacteriophage antitermination protein Q | - |
| M9380_RS13175 | 2563300..2563665 | - | 366 | WP_000140017.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M9380_RS13180 | 2563666..2564724 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| M9380_RS13185 | 2564726..2565004 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| M9380_RS13190 | 2565172..2565327 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2565339..2565397 | + | 59 | - | - | Antitoxin |
| M9380_RS13195 | 2565979..2566395 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| M9380_RS13200 | 2566422..2566562 | + | 141 | Protein_2560 | DUF4224 domain-containing protein | - |
| M9380_RS13205 | 2566562..2567602 | + | 1041 | WP_005096324.1 | tyrosine-type recombinase/integrase | - |
| M9380_RS13215 | 2567813..2568610 | + | 798 | WP_024260703.1 | DgsA anti-repressor MtfA | - |
| M9380_RS13225 | 2568948..2570210 | + | 1263 | Protein_2563 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2530605..2573518 | 42913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T246350 WP_000813254.1 NZ_CP097837:c2565327-2565172 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT246350 NZ_CP097837:2565339-2565397 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|