Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2565172..2565397 Replicon chromosome
Accession NZ_CP097837
Organism Shigella flexneri strain B

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9380_RS13190 Protein ID WP_000813254.1
Coordinates 2565172..2565327 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2565339..2565397 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9380_RS13135 2560484..2560834 - 351 WP_005049241.1 IS66 family insertion sequence element accessory protein TnpB -
M9380_RS13140 2560831..2561505 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -
M9380_RS13145 2561604..2561819 - 216 WP_000839572.1 class II holin family protein -
M9380_RS13170 2562615..2563303 - 689 Protein_2554 bacteriophage antitermination protein Q -
M9380_RS13175 2563300..2563665 - 366 WP_000140017.1 RusA family crossover junction endodeoxyribonuclease -
M9380_RS13180 2563666..2564724 - 1059 WP_001265248.1 DUF968 domain-containing protein -
M9380_RS13185 2564726..2565004 - 279 WP_011069426.1 hypothetical protein -
M9380_RS13190 2565172..2565327 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2565339..2565397 + 59 - - Antitoxin
M9380_RS13195 2565979..2566395 - 417 WP_005069274.1 hypothetical protein -
M9380_RS13200 2566422..2566562 + 141 Protein_2560 DUF4224 domain-containing protein -
M9380_RS13205 2566562..2567602 + 1041 WP_005096324.1 tyrosine-type recombinase/integrase -
M9380_RS13215 2567813..2568610 + 798 WP_024260703.1 DgsA anti-repressor MtfA -
M9380_RS13225 2568948..2570210 + 1263 Protein_2563 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 2530605..2573518 42913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246350 WP_000813254.1 NZ_CP097837:c2565327-2565172 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246350 NZ_CP097837:2565339-2565397 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References