Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1907596..1907821 | Replicon | chromosome |
Accession | NZ_CP097837 | ||
Organism | Shigella flexneri strain B |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | M9380_RS09585 | Protein ID | WP_000813254.1 |
Coordinates | 1907666..1907821 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1907596..1907654 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9380_RS09545 | 1903597..1903766 | + | 170 | Protein_1850 | hypothetical protein | - |
M9380_RS09550 | 1903912..1904655 | + | 744 | WP_000788999.1 | ATP-binding protein | - |
M9380_RS09555 | 1904670..1905092 | + | 423 | WP_001118167.1 | DUF977 family protein | - |
M9380_RS09560 | 1905150..1905506 | + | 357 | WP_005048249.1 | hypothetical protein | - |
M9380_RS09565 | 1905599..1905817 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
M9380_RS09570 | 1905819..1906184 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
M9380_RS09575 | 1906181..1906846 | + | 666 | WP_000208062.1 | hypothetical protein | - |
M9380_RS09580 | 1906846..1907211 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 1907596..1907654 | - | 59 | - | - | Antitoxin |
M9380_RS09585 | 1907666..1907821 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
M9380_RS09595 | 1909158..1909757 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
M9380_RS09600 | 1909757..1910047 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
M9380_RS09605 | 1910044..1910598 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
M9380_RS09610 | 1910739..1910924 | + | 186 | WP_005049799.1 | hypothetical protein | - |
M9380_RS09615 | 1910986..1912142 | + | 1157 | WP_094081550.1 | IS3-like element IS600 family transposase | - |
M9380_RS09620 | 1912135..1912695 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 1897030..1944313 | 47283 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T246344 WP_000813254.1 NZ_CP097837:1907666-1907821 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT246344 NZ_CP097837:c1907654-1907596 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|