Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1777900..1778120 Replicon chromosome
Accession NZ_CP097837
Organism Shigella flexneri strain B

Toxin (Protein)


Gene name ldrD Uniprot ID A0A4P7TT65
Locus tag M9380_RS08900 Protein ID WP_000170961.1
Coordinates 1777900..1778007 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1778055..1778120 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9380_RS08875 (1773744) 1773744..1774826 + 1083 WP_075332729.1 peptide chain release factor 1 -
M9380_RS08880 (1774826) 1774826..1775659 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
M9380_RS08885 (1775656) 1775656..1776048 + 393 WP_000200378.1 invasion regulator SirB2 -
M9380_RS08890 (1776052) 1776052..1776861 + 810 WP_001257041.1 invasion regulator SirB1 -
M9380_RS08895 (1776897) 1776897..1777751 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
M9380_RS08900 (1777900) 1777900..1778007 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1778055) 1778055..1778120 + 66 NuclAT_16 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_16 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_16 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_16 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_17 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_17 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_17 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_17 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_18 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_18 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_18 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_18 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_19 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_19 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_19 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_19 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_20 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_20 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_20 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_20 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_21 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_21 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_21 - Antitoxin
- (1778055) 1778055..1778120 + 66 NuclAT_21 - Antitoxin
- (1778055) 1778055..1778122 + 68 NuclAT_10 - -
- (1778055) 1778055..1778122 + 68 NuclAT_10 - -
- (1778055) 1778055..1778122 + 68 NuclAT_10 - -
- (1778055) 1778055..1778122 + 68 NuclAT_10 - -
- (1778055) 1778055..1778122 + 68 NuclAT_11 - -
- (1778055) 1778055..1778122 + 68 NuclAT_11 - -
- (1778055) 1778055..1778122 + 68 NuclAT_11 - -
- (1778055) 1778055..1778122 + 68 NuclAT_11 - -
- (1778055) 1778055..1778122 + 68 NuclAT_12 - -
- (1778055) 1778055..1778122 + 68 NuclAT_12 - -
- (1778055) 1778055..1778122 + 68 NuclAT_12 - -
- (1778055) 1778055..1778122 + 68 NuclAT_12 - -
- (1778055) 1778055..1778122 + 68 NuclAT_13 - -
- (1778055) 1778055..1778122 + 68 NuclAT_13 - -
- (1778055) 1778055..1778122 + 68 NuclAT_13 - -
- (1778055) 1778055..1778122 + 68 NuclAT_13 - -
- (1778055) 1778055..1778122 + 68 NuclAT_14 - -
- (1778055) 1778055..1778122 + 68 NuclAT_14 - -
- (1778055) 1778055..1778122 + 68 NuclAT_14 - -
- (1778055) 1778055..1778122 + 68 NuclAT_14 - -
- (1778055) 1778055..1778122 + 68 NuclAT_15 - -
- (1778055) 1778055..1778122 + 68 NuclAT_15 - -
- (1778055) 1778055..1778122 + 68 NuclAT_15 - -
- (1778055) 1778055..1778122 + 68 NuclAT_15 - -
M9380_RS08905 (1778412) 1778412..1779512 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
M9380_RS08910 (1779782) 1779782..1780012 + 231 WP_001146444.1 putative cation transport regulator ChaB -
M9380_RS08915 (1780170) 1780170..1780865 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
M9380_RS08920 (1780909) 1780909..1781262 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
M9380_RS08925 (1781447) 1781447..1782841 + 1395 WP_000086222.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T246343 WP_000170961.1 NZ_CP097837:c1778007-1777900 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 66 bp

>AT246343 NZ_CP097837:1778055-1778120 [Shigella flexneri]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TT65

Antitoxin

Download structure file

References