Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1239385..1239913 Replicon chromosome
Accession NZ_CP097837
Organism Shigella flexneri strain B

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M9380_RS06125 Protein ID WP_005061113.1
Coordinates 1239683..1239913 (-) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID Q32DW6
Locus tag M9380_RS06120 Protein ID WP_000147081.1
Coordinates 1239385..1239693 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9380_RS06085 (1235586) 1235586..1235675 + 90 Protein_1168 phage holin -
M9380_RS06100 (1238216) 1238216..1238410 + 195 Protein_1171 hypothetical protein -
M9380_RS06105 (1238485) 1238485..1238763 + 279 WP_005061104.1 hypothetical protein -
M9380_RS06110 (1238760) 1238760..1239170 + 411 WP_000814621.1 recombination protein NinB -
M9380_RS06115 (1239167) 1239167..1239343 + 177 WP_001252556.1 NinE family protein -
M9380_RS06120 (1239385) 1239385..1239693 - 309 WP_000147081.1 helix-turn-helix transcriptional regulator Antitoxin
M9380_RS06125 (1239683) 1239683..1239913 - 231 WP_005061113.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9380_RS06130 (1239926) 1239926..1240384 + 459 WP_000961311.1 ash family protein -
M9380_RS06135 (1240442) 1240442..1240894 + 453 WP_232046050.1 Rha family transcriptional regulator -
M9380_RS06140 (1240891) 1240891..1241124 + 234 WP_000618004.1 hypothetical protein -
M9380_RS06145 (1241111) 1241111..1242019 + 909 WP_001247840.1 hypothetical protein -
M9380_RS06150 (1242030) 1242030..1242908 + 879 WP_000988183.1 ATP-binding protein -
M9380_RS06155 (1242905) 1242905..1244296 + 1392 WP_000211324.1 replicative DNA helicase -
M9380_RS06160 (1244293) 1244293..1244550 + 258 WP_001064799.1 hypothetical protein -
M9380_RS06165 (1244645) 1244645..1244845 + 201 WP_000111769.1 protein ninH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH4.5 1182077..1277678 95601


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8665.12 Da        Isoelectric Point: 10.5308

>T246342 WP_005061113.1 NZ_CP097837:c1239913-1239683 [Shigella flexneri]
MKVYGSNLGEPHTSAFGDGLFELRIKGNDGIARVFYCTLTGKRIIMLHSFVKKAQKTPPAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11185.94 Da        Isoelectric Point: 8.5840

>AT246342 WP_000147081.1 NZ_CP097837:c1239693-1239385 [Shigella flexneri]
MTGKRTLPTMTHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGISG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7TJC1

References