Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 937041..937659 | Replicon | chromosome |
| Accession | NZ_CP097837 | ||
| Organism | Shigella flexneri strain B | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M9380_RS04515 | Protein ID | WP_001291435.1 |
| Coordinates | 937041..937259 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q0T7C3 |
| Locus tag | M9380_RS04520 | Protein ID | WP_000344797.1 |
| Coordinates | 937285..937659 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9380_RS04485 (932933) | 932933..933244 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| M9380_RS04495 (933623) | 933623..933976 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| M9380_RS04500 (934018) | 934018..935568 | - | 1551 | WP_005106783.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M9380_RS04505 (935732) | 935732..936202 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| M9380_RS04510 (936318) | 936318..936869 | - | 552 | WP_000102577.1 | maltose O-acetyltransferase | - |
| M9380_RS04515 (937041) | 937041..937259 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M9380_RS04520 (937285) | 937285..937659 | - | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
| M9380_RS04525 (938205) | 938205..941354 | - | 3150 | WP_001132485.1 | efflux RND transporter permease AcrB | - |
| M9380_RS04530 (941377) | 941377..942570 | - | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 931575..932903 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246341 WP_001291435.1 NZ_CP097837:c937259-937041 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT246341 WP_000344797.1 NZ_CP097837:c937659-937285 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPD8 |