Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 899859..900703 | Replicon | chromosome |
Accession | NZ_CP097837 | ||
Organism | Shigella flexneri strain B |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | M9380_RS04320 | Protein ID | WP_014532172.1 |
Coordinates | 899859..900320 (-) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | M9380_RS04325 | Protein ID | WP_005053053.1 |
Coordinates | 900392..900703 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9380_RS04305 (895027) | 895027..896757 | - | 1731 | WP_000645011.1 | hypothetical protein | - |
M9380_RS04310 (896810) | 896810..898963 | - | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
M9380_RS04315 (899114) | 899114..899811 | + | 698 | WP_232046043.1 | IS1 family transposase | - |
M9380_RS04320 (899859) | 899859..900320 | - | 462 | WP_014532172.1 | GNAT family N-acetyltransferase | Toxin |
M9380_RS04325 (900392) | 900392..900703 | - | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
M9380_RS04330 (900888) | 900888..901778 | - | 891 | WP_000971356.1 | heme o synthase | - |
M9380_RS04335 (901790) | 901790..902119 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M9380_RS04340 (902119) | 902119..902733 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M9380_RS04345 (902723) | 902723..904714 | - | 1992 | Protein_837 | cytochrome o ubiquinol oxidase subunit I | - |
M9380_RS04350 (904736) | 904736..905233 | - | 498 | Protein_838 | COX aromatic rich motif-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 899308..899811 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16623.52 Da Isoelectric Point: 9.9538
>T246340 WP_014532172.1 NZ_CP097837:c900320-899859 [Shigella flexneri]
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|