Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 818013..818707 | Replicon | chromosome |
Accession | NZ_CP097837 | ||
Organism | Shigella flexneri strain B |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | M9380_RS03895 | Protein ID | WP_001263491.1 |
Coordinates | 818013..818411 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | Q0T7Q4 |
Locus tag | M9380_RS03900 | Protein ID | WP_000554759.1 |
Coordinates | 818414..818707 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9380_RS03870 (813352) | 813352..813810 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M9380_RS03875 (814072) | 814072..815529 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
M9380_RS03880 (815586) | 815586..816200 | - | 615 | Protein_744 | peptide chain release factor H | - |
M9380_RS03885 (816262) | 816262..817305 | - | 1044 | WP_005060486.1 | RNA ligase RtcB family protein | - |
M9380_RS03890 (817551) | 817551..818003 | - | 453 | WP_001059846.1 | GNAT family N-acetyltransferase | - |
M9380_RS03895 (818013) | 818013..818411 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M9380_RS03900 (818414) | 818414..818707 | - | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M9380_RS03905 (818759) | 818759..819814 | - | 1056 | WP_001226172.1 | DNA polymerase IV | - |
M9380_RS03910 (819885) | 819885..820670 | - | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
M9380_RS03915 (820642) | 820642..822354 | + | 1713 | Protein_751 | flagellar biosynthesis protein FlhA | - |
M9380_RS03920 (822571) | 822571..823068 | - | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | gtrA / gtrB / gmhA/lpcA | 777839..854481 | 76642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T246339 WP_001263491.1 NZ_CP097837:c818411-818013 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TR46 |