Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4069905..4070632 | Replicon | chromosome |
Accession | NZ_CP097834 | ||
Organism | Shigella flexneri strain C |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | M9379_RS20570 | Protein ID | WP_000550189.1 |
Coordinates | 4069905..4070219 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M9379_RS20575 | Protein ID | WP_000560266.1 |
Coordinates | 4070216..4070632 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9379_RS20550 (4066054) | 4066054..4067052 | - | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
M9379_RS20555 (4067131) | 4067131..4067823 | - | 693 | WP_000942537.1 | vancomycin high temperature exclusion protein | - |
M9379_RS20560 (4067896) | 4067896..4068399 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
M9379_RS20565 (4068484) | 4068484..4069620 | + | 1137 | WP_000018658.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
M9379_RS20570 (4069905) | 4069905..4070219 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
M9379_RS20575 (4070216) | 4070216..4070632 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
M9379_RS20580 (4070677) | 4070677..4072695 | - | 2019 | WP_000121486.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
M9379_RS20585 (4072921) | 4072921..4075272 | - | 2352 | WP_000695506.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T246332 WP_000550189.1 NZ_CP097834:4069905-4070219 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT246332 WP_000560266.1 NZ_CP097834:4070216-4070632 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|