Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2431905..2432599 | Replicon | chromosome |
Accession | NZ_CP097834 | ||
Organism | Shigella flexneri strain C |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | M9379_RS12595 | Protein ID | WP_001263491.1 |
Coordinates | 2432201..2432599 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | Q0T7Q4 |
Locus tag | M9379_RS12590 | Protein ID | WP_000554759.1 |
Coordinates | 2431905..2432198 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9379_RS12570 (2427544) | 2427544..2428041 | + | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
M9379_RS12575 (2428258) | 2428258..2429970 | - | 1713 | Protein_2452 | flagellar biosynthesis protein FlhA | - |
M9379_RS12580 (2429942) | 2429942..2430727 | + | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
M9379_RS12585 (2430798) | 2430798..2431853 | + | 1056 | WP_001226172.1 | DNA polymerase IV | - |
M9379_RS12590 (2431905) | 2431905..2432198 | + | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M9379_RS12595 (2432201) | 2432201..2432599 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M9379_RS12600 (2432609) | 2432609..2433061 | + | 453 | WP_001059846.1 | GNAT family N-acetyltransferase | - |
M9379_RS12605 (2433307) | 2433307..2434350 | + | 1044 | WP_005060486.1 | RNA ligase RtcB family protein | - |
M9379_RS12610 (2434412) | 2434412..2435026 | + | 615 | Protein_2459 | peptide chain release factor H | - |
M9379_RS12615 (2435083) | 2435083..2436540 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
M9379_RS12620 (2436802) | 2436802..2437260 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | gtrB / gtrA | 2424985..2472773 | 47788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T246329 WP_001263491.1 NZ_CP097834:2432201-2432599 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TR46 |