Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 2349909..2350753 | Replicon | chromosome |
| Accession | NZ_CP097834 | ||
| Organism | Shigella flexneri strain C | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | - |
| Locus tag | M9379_RS12170 | Protein ID | WP_014532172.1 |
| Coordinates | 2350292..2350753 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | A5H0K0 |
| Locus tag | M9379_RS12165 | Protein ID | WP_005053053.1 |
| Coordinates | 2349909..2350220 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9379_RS12140 (2345379) | 2345379..2345876 | + | 498 | Protein_2365 | COX aromatic rich motif-containing protein | - |
| M9379_RS12145 (2345898) | 2345898..2347889 | + | 1992 | Protein_2366 | cytochrome o ubiquinol oxidase subunit I | - |
| M9379_RS12150 (2347879) | 2347879..2348493 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| M9379_RS12155 (2348493) | 2348493..2348822 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| M9379_RS12160 (2348834) | 2348834..2349724 | + | 891 | WP_000971356.1 | heme o synthase | - |
| M9379_RS12165 (2349909) | 2349909..2350220 | + | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
| M9379_RS12170 (2350292) | 2350292..2350753 | + | 462 | WP_014532172.1 | GNAT family N-acetyltransferase | Toxin |
| M9379_RS12180 (2351649) | 2351649..2353802 | + | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
| M9379_RS12185 (2353855) | 2353855..2355585 | + | 1731 | WP_000645011.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2350801..2351304 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16623.52 Da Isoelectric Point: 9.9538
>T246328 WP_014532172.1 NZ_CP097834:2350292-2350753 [Shigella flexneri]
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|