Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2312953..2313571 | Replicon | chromosome |
| Accession | NZ_CP097834 | ||
| Organism | Shigella flexneri strain C | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M9379_RS11975 | Protein ID | WP_001291435.1 |
| Coordinates | 2313353..2313571 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q0T7C3 |
| Locus tag | M9379_RS11970 | Protein ID | WP_000344797.1 |
| Coordinates | 2312953..2313327 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9379_RS11960 (2308042) | 2308042..2309235 | + | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M9379_RS11965 (2309258) | 2309258..2312407 | + | 3150 | WP_001132485.1 | efflux RND transporter permease AcrB | - |
| M9379_RS11970 (2312953) | 2312953..2313327 | + | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
| M9379_RS11975 (2313353) | 2313353..2313571 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M9379_RS11980 (2313743) | 2313743..2314294 | + | 552 | WP_000102577.1 | maltose O-acetyltransferase | - |
| M9379_RS11985 (2314410) | 2314410..2314880 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M9379_RS11990 (2315044) | 2315044..2316594 | + | 1551 | WP_005106783.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M9379_RS11995 (2316636) | 2316636..2316989 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| M9379_RS12005 (2317368) | 2317368..2317679 | + | 312 | WP_000409911.1 | MGMT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2317709..2319037 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246327 WP_001291435.1 NZ_CP097834:2313353-2313571 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT246327 WP_000344797.1 NZ_CP097834:2312953-2313327 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPD8 |