Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 2010699..2011227 Replicon chromosome
Accession NZ_CP097834
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M9379_RS10365 Protein ID WP_005061113.1
Coordinates 2010699..2010929 (+) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID Q32DW6
Locus tag M9379_RS10370 Protein ID WP_000147081.1
Coordinates 2010919..2011227 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS10325 (2005767) 2005767..2005967 - 201 WP_000111769.1 protein ninH -
M9379_RS10330 (2006062) 2006062..2006319 - 258 WP_001064799.1 hypothetical protein -
M9379_RS10335 (2006316) 2006316..2007707 - 1392 WP_000211324.1 replicative DNA helicase -
M9379_RS10340 (2007704) 2007704..2008582 - 879 WP_000988183.1 ATP-binding protein -
M9379_RS10345 (2008593) 2008593..2009501 - 909 WP_001247840.1 hypothetical protein -
M9379_RS10350 (2009488) 2009488..2009721 - 234 WP_000618004.1 hypothetical protein -
M9379_RS10355 (2009718) 2009718..2010170 - 453 WP_232046050.1 Rha family transcriptional regulator -
M9379_RS10360 (2010228) 2010228..2010686 - 459 WP_000961311.1 ash family protein -
M9379_RS10365 (2010699) 2010699..2010929 + 231 WP_005061113.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9379_RS10370 (2010919) 2010919..2011227 + 309 WP_000147081.1 helix-turn-helix transcriptional regulator Antitoxin
M9379_RS10375 (2011269) 2011269..2011445 - 177 WP_001252556.1 NinE family protein -
M9379_RS10380 (2011442) 2011442..2011852 - 411 WP_000814621.1 recombination protein NinB -
M9379_RS10385 (2011849) 2011849..2012127 - 279 WP_005061104.1 hypothetical protein -
M9379_RS10390 (2012202) 2012202..2012396 - 195 Protein_2032 hypothetical protein -
M9379_RS10395 (2012466) 2012466..2013634 + 1169 WP_000747032.1 IS3-like element IS911 family transposase -
M9379_RS10400 (2013764) 2013764..2014893 + 1130 WP_112361761.1 IS3-like element ISSfl10 family transposase -
M9379_RS10405 (2014937) 2014937..2015026 - 90 Protein_2035 phage holin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH4.5 1972934..2066566 93632


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8665.12 Da        Isoelectric Point: 10.5308

>T246326 WP_005061113.1 NZ_CP097834:2010699-2010929 [Shigella flexneri]
MKVYGSNLGEPHTSAFGDGLFELRIKGNDGIARVFYCTLTGKRIIMLHSFVKKAQKTPPAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11185.94 Da        Isoelectric Point: 8.5840

>AT246326 WP_000147081.1 NZ_CP097834:2010919-2011227 [Shigella flexneri]
MTGKRTLPTMTHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGISG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7TJC1

References