Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1342796..1343021 Replicon chromosome
Accession NZ_CP097834
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9379_RS06905 Protein ID WP_000813254.1
Coordinates 1342796..1342951 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1342963..1343021 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS06870 1337922..1338482 - 561 WP_072075205.1 ORF6N domain-containing protein -
M9379_RS06880 1339693..1339878 - 186 WP_005049799.1 hypothetical protein -
M9379_RS06885 1340019..1340573 - 555 WP_000640143.1 DUF1133 family protein -
M9379_RS06890 1340570..1340860 - 291 WP_000228038.1 DUF1364 domain-containing protein -
M9379_RS06895 1340860..1341459 - 600 WP_000940329.1 DUF1367 family protein -
M9379_RS06900 1341593..1342290 + 698 WP_227804319.1 IS1 family transposase -
M9379_RS06905 1342796..1342951 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 1342963..1343021 + 59 - - Antitoxin
M9379_RS06910 1343406..1343771 - 366 WP_000610655.1 DUF551 domain-containing protein -
M9379_RS06915 1343771..1344436 - 666 WP_000208062.1 hypothetical protein -
M9379_RS06920 1344433..1344798 - 366 WP_001229298.1 HNH endonuclease signature motif containing protein -
M9379_RS06925 1344800..1345018 - 219 WP_000256998.1 DUF4014 family protein -
M9379_RS06930 1345111..1345467 - 357 WP_005048249.1 hypothetical protein -
M9379_RS06935 1345525..1345947 - 423 WP_001118167.1 DUF977 family protein -
M9379_RS06940 1345962..1346705 - 744 WP_000788999.1 ATP-binding protein -
M9379_RS06945 1346851..1347020 - 170 Protein_1353 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage sitABCD ipaH9.8 1300936..1353585 52649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246325 WP_000813254.1 NZ_CP097834:c1342951-1342796 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246325 NZ_CP097834:1342963-1343021 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References