Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 685222..685447 Replicon chromosome
Accession NZ_CP097834
Organism Shigella flexneri strain C

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9379_RS03315 Protein ID WP_000813254.1
Coordinates 685292..685447 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 685222..685280 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9379_RS03280 680409..681671 - 1263 Protein_642 tyrosine-type recombinase/integrase -
M9379_RS03290 682009..682806 - 798 WP_024260703.1 DgsA anti-repressor MtfA -
M9379_RS03300 683017..684057 - 1041 WP_005096324.1 tyrosine-type recombinase/integrase -
M9379_RS03305 684057..684197 - 141 Protein_645 DUF4224 domain-containing protein -
M9379_RS03310 684224..684640 + 417 WP_005069274.1 hypothetical protein -
- 685222..685280 - 59 - - Antitoxin
M9379_RS03315 685292..685447 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
M9379_RS03320 685615..685893 + 279 WP_011069426.1 hypothetical protein -
M9379_RS03325 685895..686953 + 1059 WP_001265248.1 DUF968 domain-containing protein -
M9379_RS03330 686954..687319 + 366 WP_000140017.1 RusA family crossover junction endodeoxyribonuclease -
M9379_RS03335 687316..688004 + 689 Protein_651 bacteriophage antitermination protein Q -
M9379_RS03360 688800..689015 + 216 WP_000839572.1 class II holin family protein -
M9379_RS03365 689114..689788 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
M9379_RS03370 689785..690135 + 351 WP_005049241.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 645317..720014 74697


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246319 WP_000813254.1 NZ_CP097834:685292-685447 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246319 NZ_CP097834:c685280-685222 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References