Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 685222..685447 | Replicon | chromosome |
| Accession | NZ_CP097834 | ||
| Organism | Shigella flexneri strain C | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | M9379_RS03315 | Protein ID | WP_000813254.1 |
| Coordinates | 685292..685447 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 685222..685280 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9379_RS03280 | 680409..681671 | - | 1263 | Protein_642 | tyrosine-type recombinase/integrase | - |
| M9379_RS03290 | 682009..682806 | - | 798 | WP_024260703.1 | DgsA anti-repressor MtfA | - |
| M9379_RS03300 | 683017..684057 | - | 1041 | WP_005096324.1 | tyrosine-type recombinase/integrase | - |
| M9379_RS03305 | 684057..684197 | - | 141 | Protein_645 | DUF4224 domain-containing protein | - |
| M9379_RS03310 | 684224..684640 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 685222..685280 | - | 59 | - | - | Antitoxin |
| M9379_RS03315 | 685292..685447 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| M9379_RS03320 | 685615..685893 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| M9379_RS03325 | 685895..686953 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| M9379_RS03330 | 686954..687319 | + | 366 | WP_000140017.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M9379_RS03335 | 687316..688004 | + | 689 | Protein_651 | bacteriophage antitermination protein Q | - |
| M9379_RS03360 | 688800..689015 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| M9379_RS03365 | 689114..689788 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| M9379_RS03370 | 689785..690135 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 645317..720014 | 74697 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T246319 WP_000813254.1 NZ_CP097834:685292-685447 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT246319 NZ_CP097834:c685280-685222 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|