Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4475936..4476630 | Replicon | chromosome |
| Accession | NZ_CP097831 | ||
| Organism | Shigella flexneri strain D | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | M9381_RS22540 | Protein ID | WP_001263491.1 |
| Coordinates | 4476232..4476630 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | Q0T7Q4 |
| Locus tag | M9381_RS22535 | Protein ID | WP_000554759.1 |
| Coordinates | 4475936..4476229 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9381_RS22515 (4471575) | 4471575..4472072 | + | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
| M9381_RS22520 (4472289) | 4472289..4474001 | - | 1713 | Protein_4383 | flagellar biosynthesis protein FlhA | - |
| M9381_RS22525 (4473973) | 4473973..4474758 | + | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
| M9381_RS22530 (4474829) | 4474829..4475884 | + | 1056 | WP_001226172.1 | DNA polymerase IV | - |
| M9381_RS22535 (4475936) | 4475936..4476229 | + | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M9381_RS22540 (4476232) | 4476232..4476630 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M9381_RS22545 (4476640) | 4476640..4477092 | + | 453 | WP_001059846.1 | GNAT family N-acetyltransferase | - |
| M9381_RS22550 (4477338) | 4477338..4478381 | + | 1044 | WP_005060486.1 | RNA ligase RtcB family protein | - |
| M9381_RS22555 (4478443) | 4478443..4479057 | + | 615 | Protein_4390 | peptide chain release factor H | - |
| M9381_RS22560 (4479114) | 4479114..4480571 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| M9381_RS22565 (4480833) | 4480833..4481291 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T246313 WP_001263491.1 NZ_CP097831:4476232-4476630 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TR46 |