Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4393940..4394784 | Replicon | chromosome |
Accession | NZ_CP097831 | ||
Organism | Shigella flexneri strain D |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | M9381_RS22115 | Protein ID | WP_014532172.1 |
Coordinates | 4394323..4394784 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | M9381_RS22110 | Protein ID | WP_005053053.1 |
Coordinates | 4393940..4394251 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9381_RS22085 (4389410) | 4389410..4389907 | + | 498 | Protein_4296 | COX aromatic rich motif-containing protein | - |
M9381_RS22090 (4389929) | 4389929..4391920 | + | 1992 | Protein_4297 | cytochrome o ubiquinol oxidase subunit I | - |
M9381_RS22095 (4391910) | 4391910..4392524 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M9381_RS22100 (4392524) | 4392524..4392853 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M9381_RS22105 (4392865) | 4392865..4393755 | + | 891 | WP_000971356.1 | heme o synthase | - |
M9381_RS22110 (4393940) | 4393940..4394251 | + | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
M9381_RS22115 (4394323) | 4394323..4394784 | + | 462 | WP_014532172.1 | GNAT family N-acetyltransferase | Toxin |
M9381_RS22125 (4395680) | 4395680..4397833 | + | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
M9381_RS22130 (4397886) | 4397886..4399616 | + | 1731 | WP_000645011.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4394832..4395335 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16623.52 Da Isoelectric Point: 9.9538
>T246312 WP_014532172.1 NZ_CP097831:4394323-4394784 [Shigella flexneri]
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|