Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4356984..4357602 | Replicon | chromosome |
Accession | NZ_CP097831 | ||
Organism | Shigella flexneri strain D |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M9381_RS21920 | Protein ID | WP_001291435.1 |
Coordinates | 4357384..4357602 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q0T7C3 |
Locus tag | M9381_RS21915 | Protein ID | WP_000344797.1 |
Coordinates | 4356984..4357358 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9381_RS21905 (4352073) | 4352073..4353266 | + | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M9381_RS21910 (4353289) | 4353289..4356438 | + | 3150 | WP_001132485.1 | efflux RND transporter permease AcrB | - |
M9381_RS21915 (4356984) | 4356984..4357358 | + | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
M9381_RS21920 (4357384) | 4357384..4357602 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M9381_RS21925 (4357774) | 4357774..4358325 | + | 552 | WP_000102577.1 | maltose O-acetyltransferase | - |
M9381_RS21930 (4358441) | 4358441..4358911 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M9381_RS21935 (4359075) | 4359075..4360625 | + | 1551 | WP_005106783.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M9381_RS21940 (4360667) | 4360667..4361020 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M9381_RS21950 (4361399) | 4361399..4361710 | + | 312 | WP_000409911.1 | MGMT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4361740..4363068 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246311 WP_001291435.1 NZ_CP097831:4357384-4357602 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT246311 WP_000344797.1 NZ_CP097831:4356984-4357358 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPD8 |