Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 4054730..4055258 Replicon chromosome
Accession NZ_CP097831
Organism Shigella flexneri strain D

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M9381_RS20310 Protein ID WP_005061113.1
Coordinates 4054730..4054960 (+) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID Q32DW6
Locus tag M9381_RS20315 Protein ID WP_000147081.1
Coordinates 4054950..4055258 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9381_RS20270 (4049798) 4049798..4049998 - 201 WP_000111769.1 protein ninH -
M9381_RS20275 (4050093) 4050093..4050350 - 258 WP_001064799.1 hypothetical protein -
M9381_RS20280 (4050347) 4050347..4051738 - 1392 WP_000211324.1 replicative DNA helicase -
M9381_RS20285 (4051735) 4051735..4052613 - 879 WP_000988183.1 ATP-binding protein -
M9381_RS20290 (4052624) 4052624..4053532 - 909 WP_001247840.1 hypothetical protein -
M9381_RS20295 (4053519) 4053519..4053752 - 234 WP_000618004.1 hypothetical protein -
M9381_RS20300 (4053749) 4053749..4054201 - 453 WP_232046050.1 Rha family transcriptional regulator -
M9381_RS20305 (4054259) 4054259..4054717 - 459 WP_000961311.1 ash family protein -
M9381_RS20310 (4054730) 4054730..4054960 + 231 WP_005061113.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9381_RS20315 (4054950) 4054950..4055258 + 309 WP_000147081.1 helix-turn-helix transcriptional regulator Antitoxin
M9381_RS20320 (4055300) 4055300..4055476 - 177 WP_001252556.1 NinE family protein -
M9381_RS20325 (4055473) 4055473..4055883 - 411 WP_000814621.1 recombination protein NinB -
M9381_RS20330 (4055880) 4055880..4056158 - 279 WP_005061104.1 hypothetical protein -
M9381_RS20335 (4056233) 4056233..4056427 - 195 Protein_3963 hypothetical protein -
M9381_RS20340 (4056497) 4056497..4057665 + 1169 WP_000747032.1 IS3-like element IS911 family transposase -
M9381_RS20345 (4057795) 4057795..4058924 + 1130 WP_112361761.1 IS3-like element ISSfl10 family transposase -
M9381_RS20350 (4058968) 4058968..4059057 - 90 Protein_3966 phage holin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH4.5 4016965..4123666 106701


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8665.12 Da        Isoelectric Point: 10.5308

>T246310 WP_005061113.1 NZ_CP097831:4054730-4054960 [Shigella flexneri]
MKVYGSNLGEPHTSAFGDGLFELRIKGNDGIARVFYCTLTGKRIIMLHSFVKKAQKTPPAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11185.94 Da        Isoelectric Point: 8.5840

>AT246310 WP_000147081.1 NZ_CP097831:4054950-4055258 [Shigella flexneri]
MTGKRTLPTMTHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGISG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7TJC1

References