Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 3386827..3387052 Replicon chromosome
Accession NZ_CP097831
Organism Shigella flexneri strain D

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9381_RS16850 Protein ID WP_000813254.1
Coordinates 3386827..3386982 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 3386994..3387052 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9381_RS16815 3381953..3382513 - 561 WP_072075205.1 ORF6N domain-containing protein -
M9381_RS16825 3383724..3383909 - 186 WP_005049799.1 hypothetical protein -
M9381_RS16830 3384050..3384604 - 555 WP_000640143.1 DUF1133 family protein -
M9381_RS16835 3384601..3384891 - 291 WP_000228038.1 DUF1364 domain-containing protein -
M9381_RS16840 3384891..3385490 - 600 WP_000940329.1 DUF1367 family protein -
M9381_RS16845 3385624..3386321 + 698 WP_227804319.1 IS1 family transposase -
M9381_RS16850 3386827..3386982 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 3386994..3387052 + 59 - - Antitoxin
M9381_RS16855 3387437..3387802 - 366 WP_000610655.1 DUF551 domain-containing protein -
M9381_RS16860 3387802..3388467 - 666 WP_000208062.1 hypothetical protein -
M9381_RS16865 3388464..3388829 - 366 WP_001229298.1 HNH endonuclease signature motif containing protein -
M9381_RS16870 3388831..3389049 - 219 WP_000256998.1 DUF4014 family protein -
M9381_RS16875 3389142..3389498 - 357 WP_005048249.1 hypothetical protein -
M9381_RS16880 3389556..3389978 - 423 WP_001118167.1 DUF977 family protein -
M9381_RS16885 3389993..3390736 - 744 WP_000788999.1 ATP-binding protein -
M9381_RS16890 3390882..3391051 - 170 Protein_3284 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage sitABCD ipaH9.8 3344967..3397617 52650


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246309 WP_000813254.1 NZ_CP097831:c3386982-3386827 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246309 NZ_CP097831:3386994-3387052 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References