Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2729253..2729478 Replicon chromosome
Accession NZ_CP097831
Organism Shigella flexneri strain D

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9381_RS13260 Protein ID WP_000813254.1
Coordinates 2729323..2729478 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2729253..2729311 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9381_RS13225 2724440..2725702 - 1263 Protein_2573 tyrosine-type recombinase/integrase -
M9381_RS13235 2726040..2726837 - 798 WP_024260703.1 DgsA anti-repressor MtfA -
M9381_RS13245 2727048..2728088 - 1041 WP_005096324.1 tyrosine-type recombinase/integrase -
M9381_RS13250 2728088..2728228 - 141 Protein_2576 DUF4224 domain-containing protein -
M9381_RS13255 2728255..2728671 + 417 WP_005069274.1 hypothetical protein -
- 2729253..2729311 - 59 - - Antitoxin
M9381_RS13260 2729323..2729478 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
M9381_RS13265 2729646..2729924 + 279 WP_011069426.1 hypothetical protein -
M9381_RS13270 2729926..2730984 + 1059 WP_001265248.1 DUF968 domain-containing protein -
M9381_RS13275 2730985..2731350 + 366 WP_000140017.1 RusA family crossover junction endodeoxyribonuclease -
M9381_RS13280 2731347..2732035 + 689 Protein_2582 bacteriophage antitermination protein Q -
M9381_RS13305 2732831..2733046 + 216 WP_000839572.1 class II holin family protein -
M9381_RS13310 2733145..2733819 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
M9381_RS13315 2733816..2734166 + 351 WP_005049241.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 2721132..2764045 42913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246303 WP_000813254.1 NZ_CP097831:2729323-2729478 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246303 NZ_CP097831:c2729311-2729253 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References