Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1596968..1597695 | Replicon | chromosome |
Accession | NZ_CP097831 | ||
Organism | Shigella flexneri strain D |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | M9381_RS07735 | Protein ID | WP_000550189.1 |
Coordinates | 1596968..1597282 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M9381_RS07740 | Protein ID | WP_000560266.1 |
Coordinates | 1597279..1597695 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9381_RS07715 (1593117) | 1593117..1594115 | - | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
M9381_RS07720 (1594194) | 1594194..1594886 | - | 693 | WP_000942537.1 | vancomycin high temperature exclusion protein | - |
M9381_RS07725 (1594959) | 1594959..1595462 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
M9381_RS07730 (1595547) | 1595547..1596683 | + | 1137 | WP_000018658.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
M9381_RS07735 (1596968) | 1596968..1597282 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
M9381_RS07740 (1597279) | 1597279..1597695 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
M9381_RS07745 (1597740) | 1597740..1599758 | - | 2019 | WP_000121486.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
M9381_RS07750 (1599984) | 1599984..1602335 | - | 2352 | WP_000695506.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T246301 WP_000550189.1 NZ_CP097831:1596968-1597282 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT246301 WP_000560266.1 NZ_CP097831:1597279-1597695 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|