Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1155404..1155626 | Replicon | chromosome |
| Accession | NZ_CP097831 | ||
| Organism | Shigella flexneri strain D | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | M9381_RS05470 | Protein ID | WP_001295224.1 |
| Coordinates | 1155519..1155626 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1155404..1155470 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9381_RS05450 | 1150845..1151747 | + | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
| M9381_RS05455 | 1151758..1152741 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| M9381_RS05460 | 1152738..1153742 | + | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| M9381_RS05465 | 1153772..1155043 | - | 1272 | WP_005052340.1 | aromatic amino acid transport family protein | - |
| - | 1155404..1155470 | - | 67 | - | - | Antitoxin |
| M9381_RS05470 | 1155519..1155626 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1155888..1155945 | - | 58 | NuclAT_23 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_23 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_23 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_23 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_25 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_25 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_25 | - | - |
| - | 1155888..1155945 | - | 58 | NuclAT_25 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_27 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_27 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_27 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_27 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_29 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_29 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_29 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_29 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_31 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_31 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_31 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_31 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_33 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_33 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_33 | - | - |
| - | 1155890..1155945 | - | 56 | NuclAT_33 | - | - |
| M9381_RS05475 | 1156002..1156109 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1156371..1156428 | - | 58 | NuclAT_22 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_22 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_22 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_22 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_24 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_24 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_24 | - | - |
| - | 1156371..1156428 | - | 58 | NuclAT_24 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_26 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_26 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_26 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_26 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_28 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_28 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_28 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_28 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_30 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_30 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_30 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_30 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_32 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_32 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_32 | - | - |
| - | 1156373..1156428 | - | 56 | NuclAT_32 | - | - |
| M9381_RS05480 | 1156485..1156592 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| M9381_RS05485 | 1156679..1158358 | - | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| M9381_RS05490 | 1158355..1158546 | - | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| M9381_RS05495 | 1158543..1160114 | - | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| M9381_RS05500 | 1160387..1160575 | + | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T246299 WP_001295224.1 NZ_CP097831:1155519-1155626 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT246299 NZ_CP097831:c1155470-1155404 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
