Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4003581..4003806 | Replicon | chromosome |
| Accession | NZ_CP097828 | ||
| Organism | Shigella flexneri strain E | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | M9383_RS20080 | Protein ID | WP_000813254.1 |
| Coordinates | 4003651..4003806 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4003581..4003639 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9383_RS20040 | 3999582..3999751 | + | 170 | Protein_3891 | hypothetical protein | - |
| M9383_RS20045 | 3999897..4000640 | + | 744 | WP_000788999.1 | ATP-binding protein | - |
| M9383_RS20050 | 4000655..4001077 | + | 423 | WP_001118167.1 | DUF977 family protein | - |
| M9383_RS20055 | 4001135..4001491 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| M9383_RS20060 | 4001584..4001802 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| M9383_RS20065 | 4001804..4002169 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
| M9383_RS20070 | 4002166..4002831 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| M9383_RS20075 | 4002831..4003196 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 4003581..4003639 | - | 59 | - | - | Antitoxin |
| M9383_RS20080 | 4003651..4003806 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| M9383_RS20090 | 4005143..4005742 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| M9383_RS20095 | 4005742..4006032 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| M9383_RS20100 | 4006029..4006583 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| M9383_RS20105 | 4006736..4006909 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| M9383_RS20110 | 4006971..4008127 | + | 1157 | WP_094081550.1 | IS3-like element IS600 family transposase | - |
| M9383_RS20115 | 4008120..4008680 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 3993015..4055688 | 62673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T246288 WP_000813254.1 NZ_CP097828:4003651-4003806 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT246288 NZ_CP097828:c4003639-4003581 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|