Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3873886..3874106 Replicon chromosome
Accession NZ_CP097828
Organism Shigella flexneri strain E

Toxin (Protein)


Gene name ldrD Uniprot ID A0A4P7TT65
Locus tag M9383_RS19395 Protein ID WP_000170961.1
Coordinates 3873886..3873993 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3874041..3874106 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9383_RS19370 (3869730) 3869730..3870812 + 1083 WP_075332729.1 peptide chain release factor 1 -
M9383_RS19375 (3870812) 3870812..3871645 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
M9383_RS19380 (3871642) 3871642..3872034 + 393 WP_000200378.1 invasion regulator SirB2 -
M9383_RS19385 (3872038) 3872038..3872847 + 810 WP_001257041.1 invasion regulator SirB1 -
M9383_RS19390 (3872883) 3872883..3873737 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
M9383_RS19395 (3873886) 3873886..3873993 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3874041) 3874041..3874106 + 66 NuclAT_16 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_16 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_16 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_16 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_17 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_17 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_17 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_17 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_18 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_18 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_18 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_18 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_19 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_19 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_19 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_19 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_20 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_20 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_20 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_20 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_21 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_21 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_21 - Antitoxin
- (3874041) 3874041..3874106 + 66 NuclAT_21 - Antitoxin
- (3874041) 3874041..3874108 + 68 NuclAT_10 - -
- (3874041) 3874041..3874108 + 68 NuclAT_10 - -
- (3874041) 3874041..3874108 + 68 NuclAT_10 - -
- (3874041) 3874041..3874108 + 68 NuclAT_10 - -
- (3874041) 3874041..3874108 + 68 NuclAT_11 - -
- (3874041) 3874041..3874108 + 68 NuclAT_11 - -
- (3874041) 3874041..3874108 + 68 NuclAT_11 - -
- (3874041) 3874041..3874108 + 68 NuclAT_11 - -
- (3874041) 3874041..3874108 + 68 NuclAT_12 - -
- (3874041) 3874041..3874108 + 68 NuclAT_12 - -
- (3874041) 3874041..3874108 + 68 NuclAT_12 - -
- (3874041) 3874041..3874108 + 68 NuclAT_12 - -
- (3874041) 3874041..3874108 + 68 NuclAT_13 - -
- (3874041) 3874041..3874108 + 68 NuclAT_13 - -
- (3874041) 3874041..3874108 + 68 NuclAT_13 - -
- (3874041) 3874041..3874108 + 68 NuclAT_13 - -
- (3874041) 3874041..3874108 + 68 NuclAT_14 - -
- (3874041) 3874041..3874108 + 68 NuclAT_14 - -
- (3874041) 3874041..3874108 + 68 NuclAT_14 - -
- (3874041) 3874041..3874108 + 68 NuclAT_14 - -
- (3874041) 3874041..3874108 + 68 NuclAT_15 - -
- (3874041) 3874041..3874108 + 68 NuclAT_15 - -
- (3874041) 3874041..3874108 + 68 NuclAT_15 - -
- (3874041) 3874041..3874108 + 68 NuclAT_15 - -
M9383_RS19400 (3874398) 3874398..3875498 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
M9383_RS19405 (3875768) 3875768..3875998 + 231 WP_001146444.1 putative cation transport regulator ChaB -
M9383_RS19410 (3876156) 3876156..3876851 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
M9383_RS19415 (3876895) 3876895..3877248 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
M9383_RS19420 (3877433) 3877433..3878827 + 1395 WP_000086222.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T246287 WP_000170961.1 NZ_CP097828:c3873993-3873886 [Shigella flexneri]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 66 bp

>AT246287 NZ_CP097828:3874041-3874106 [Shigella flexneri]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TT65

Antitoxin

Download structure file

References