Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 3335371..3335899 Replicon chromosome
Accession NZ_CP097828
Organism Shigella flexneri strain E

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag M9383_RS16615 Protein ID WP_005061113.1
Coordinates 3335669..3335899 (-) Length 77 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID Q32DW6
Locus tag M9383_RS16610 Protein ID WP_000147081.1
Coordinates 3335371..3335679 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9383_RS16575 (3331572) 3331572..3331661 + 90 Protein_3208 phage holin -
M9383_RS16590 (3334202) 3334202..3334396 + 195 Protein_3211 hypothetical protein -
M9383_RS16595 (3334471) 3334471..3334749 + 279 WP_005061104.1 hypothetical protein -
M9383_RS16600 (3334746) 3334746..3335156 + 411 WP_000814621.1 recombination protein NinB -
M9383_RS16605 (3335153) 3335153..3335329 + 177 WP_001252556.1 NinE family protein -
M9383_RS16610 (3335371) 3335371..3335679 - 309 WP_000147081.1 helix-turn-helix transcriptional regulator Antitoxin
M9383_RS16615 (3335669) 3335669..3335899 - 231 WP_005061113.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9383_RS16620 (3335912) 3335912..3336370 + 459 WP_000961311.1 ash family protein -
M9383_RS16625 (3336428) 3336428..3336880 + 453 WP_232046050.1 Rha family transcriptional regulator -
M9383_RS16630 (3336877) 3336877..3337110 + 234 WP_000618004.1 hypothetical protein -
M9383_RS16635 (3337097) 3337097..3338005 + 909 WP_001247840.1 hypothetical protein -
M9383_RS16640 (3338016) 3338016..3338894 + 879 WP_000988183.1 ATP-binding protein -
M9383_RS16645 (3338891) 3338891..3340282 + 1392 WP_000211324.1 replicative DNA helicase -
M9383_RS16650 (3340279) 3340279..3340536 + 258 WP_001064799.1 hypothetical protein -
M9383_RS16655 (3340631) 3340631..3340831 + 201 WP_000111769.1 protein ninH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH4.5 3278063..3373664 95601


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(5-70)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8665.12 Da        Isoelectric Point: 10.5308

>T246286 WP_005061113.1 NZ_CP097828:c3335899-3335669 [Shigella flexneri]
MKVYGSNLGEPHTSAFGDGLFELRIKGNDGIARVFYCTLTGKRIIMLHSFVKKAQKTPPAERKKAETRMKEVKHDW

Download         Length: 231 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11185.94 Da        Isoelectric Point: 8.5840

>AT246286 WP_000147081.1 NZ_CP097828:c3335679-3335371 [Shigella flexneri]
MTGKRTLPTMTHDEMAAKWMEDPAFKAEYDAIADEFALLDEMLAARKEAGLTQAEVAERMGTKATAITRMESNLASGISG
PSFATLKKFARATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7TJC1

References