Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3033027..3033645 | Replicon | chromosome |
Accession | NZ_CP097828 | ||
Organism | Shigella flexneri strain E |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M9383_RS15005 | Protein ID | WP_001291435.1 |
Coordinates | 3033027..3033245 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q0T7C3 |
Locus tag | M9383_RS15010 | Protein ID | WP_000344797.1 |
Coordinates | 3033271..3033645 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9383_RS14975 (3028919) | 3028919..3029230 | - | 312 | WP_000409911.1 | MGMT family protein | - |
M9383_RS14985 (3029609) | 3029609..3029962 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M9383_RS14990 (3030004) | 3030004..3031554 | - | 1551 | WP_005106783.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M9383_RS14995 (3031718) | 3031718..3032188 | - | 471 | WP_000136192.1 | YlaC family protein | - |
M9383_RS15000 (3032304) | 3032304..3032855 | - | 552 | WP_000102577.1 | maltose O-acetyltransferase | - |
M9383_RS15005 (3033027) | 3033027..3033245 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M9383_RS15010 (3033271) | 3033271..3033645 | - | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
M9383_RS15015 (3034191) | 3034191..3037340 | - | 3150 | WP_001132485.1 | efflux RND transporter permease AcrB | - |
M9383_RS15020 (3037363) | 3037363..3038556 | - | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3027561..3028889 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246285 WP_001291435.1 NZ_CP097828:c3033245-3033027 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT246285 WP_000344797.1 NZ_CP097828:c3033645-3033271 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPD8 |