Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 2995845..2996689 | Replicon | chromosome |
Accession | NZ_CP097828 | ||
Organism | Shigella flexneri strain E |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A4P7TPN5 |
Locus tag | M9383_RS14805 | Protein ID | WP_005060796.1 |
Coordinates | 2995845..2996243 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | M9383_RS14815 | Protein ID | WP_005053053.1 |
Coordinates | 2996378..2996689 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9383_RS14790 (2991013) | 2991013..2992743 | - | 1731 | WP_000645011.1 | hypothetical protein | - |
M9383_RS14795 (2992796) | 2992796..2994949 | - | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
M9383_RS14800 (2995100) | 2995100..2995797 | + | 698 | WP_232046043.1 | IS1 family transposase | - |
M9383_RS14805 (2995845) | 2995845..2996243 | - | 399 | WP_005060796.1 | GNAT family N-acetyltransferase | Toxin |
M9383_RS14810 (2996236) | 2996236..2996394 | - | 159 | WP_005053055.1 | hypothetical protein | - |
M9383_RS14815 (2996378) | 2996378..2996689 | - | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
M9383_RS14820 (2996874) | 2996874..2997764 | - | 891 | WP_000971356.1 | heme o synthase | - |
M9383_RS14825 (2997776) | 2997776..2998105 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M9383_RS14830 (2998105) | 2998105..2998719 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M9383_RS14835 (2998709) | 2998709..3000700 | - | 1992 | Protein_2877 | cytochrome o ubiquinol oxidase subunit I | - |
M9383_RS14840 (3000722) | 3000722..3001219 | - | 498 | Protein_2878 | COX aromatic rich motif-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2995294..2995797 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14335.69 Da Isoelectric Point: 9.1674
>T246283 WP_005060796.1 NZ_CP097828:c2996243-2995845 [Shigella flexneri]
VRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKK
IHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
VRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKK
IHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A5H0K0 |