Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 2913999..2914693 | Replicon | chromosome |
| Accession | NZ_CP097828 | ||
| Organism | Shigella flexneri strain E | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | M9383_RS14380 | Protein ID | WP_001263491.1 |
| Coordinates | 2913999..2914397 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | Q0T7Q4 |
| Locus tag | M9383_RS14385 | Protein ID | WP_000554759.1 |
| Coordinates | 2914400..2914693 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9383_RS14355 (2909338) | 2909338..2909796 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M9383_RS14360 (2910058) | 2910058..2911515 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| M9383_RS14365 (2911572) | 2911572..2912132 | - | 561 | Protein_2783 | peptide chain release factor H | - |
| M9383_RS14370 (2912248) | 2912248..2913291 | - | 1044 | WP_005060486.1 | RNA ligase RtcB family protein | - |
| M9383_RS14375 (2913537) | 2913537..2913989 | - | 453 | WP_001059846.1 | GNAT family N-acetyltransferase | - |
| M9383_RS14380 (2913999) | 2913999..2914397 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M9383_RS14385 (2914400) | 2914400..2914693 | - | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M9383_RS14390 (2914745) | 2914745..2915800 | - | 1056 | WP_001226172.1 | DNA polymerase IV | - |
| M9383_RS14395 (2915871) | 2915871..2916656 | - | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
| M9383_RS14400 (2916628) | 2916628..2918340 | + | 1713 | Protein_2790 | flagellar biosynthesis protein FlhA | - |
| M9383_RS14405 (2918557) | 2918557..2919054 | - | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | gtrB / gmhA/lpcA | 2873825..2962866 | 89041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T246282 WP_001263491.1 NZ_CP097828:c2914397-2913999 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TR46 |