Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1717208..1717430 | Replicon | chromosome |
| Accession | NZ_CP097828 | ||
| Organism | Shigella flexneri strain E | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | M9383_RS08670 | Protein ID | WP_001295224.1 |
| Coordinates | 1717208..1717315 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1717364..1717430 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9383_RS08640 | 1712259..1712447 | - | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
| M9383_RS08645 | 1712720..1714291 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| M9383_RS08650 | 1714288..1714479 | + | 192 | WP_000988299.1 | cellulose biosynthesis protein BcsF | - |
| M9383_RS08655 | 1714476..1716155 | + | 1680 | WP_000191557.1 | cellulose biosynthesis protein BcsG | - |
| M9383_RS08660 | 1716242..1716349 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1716406..1716461 | + | 56 | NuclAT_26 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_26 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_26 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_26 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_28 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_28 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_28 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_28 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_30 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_30 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_30 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_30 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_32 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_32 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_32 | - | - |
| - | 1716406..1716461 | + | 56 | NuclAT_32 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_22 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_22 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_22 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_22 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_24 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_24 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_24 | - | - |
| - | 1716406..1716463 | + | 58 | NuclAT_24 | - | - |
| M9383_RS08665 | 1716725..1716832 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1716889..1716944 | + | 56 | NuclAT_27 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_27 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_27 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_27 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_29 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_29 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_29 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_29 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_31 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_31 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_31 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_31 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_33 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_33 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_33 | - | - |
| - | 1716889..1716944 | + | 56 | NuclAT_33 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_23 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_23 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_23 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_23 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_25 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_25 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_25 | - | - |
| - | 1716889..1716946 | + | 58 | NuclAT_25 | - | - |
| M9383_RS08670 | 1717208..1717315 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1717364..1717430 | + | 67 | - | - | Antitoxin |
| M9383_RS08675 | 1717791..1719062 | + | 1272 | WP_005052340.1 | aromatic amino acid transport family protein | - |
| M9383_RS08680 | 1719092..1720096 | - | 1005 | WP_000107041.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| M9383_RS08685 | 1720093..1721076 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| M9383_RS08690 | 1721087..1721989 | - | 903 | WP_000084666.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T246281 WP_001295224.1 NZ_CP097828:c1717315-1717208 [Shigella flexneri]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT246281 NZ_CP097828:1717364-1717430 [Shigella flexneri]
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTTATGTTGTCAGGTACATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
