Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1275140..1275867 | Replicon | chromosome |
| Accession | NZ_CP097828 | ||
| Organism | Shigella flexneri strain E | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | M9383_RS06415 | Protein ID | WP_000550189.1 |
| Coordinates | 1275553..1275867 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9383_RS06410 | Protein ID | WP_000560266.1 |
| Coordinates | 1275140..1275556 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9383_RS06400 (1270500) | 1270500..1272851 | + | 2352 | WP_000695506.1 | alpha-glucosidase | - |
| M9383_RS06405 (1273077) | 1273077..1275095 | + | 2019 | WP_000121486.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| M9383_RS06410 (1275140) | 1275140..1275556 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| M9383_RS06415 (1275553) | 1275553..1275867 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| M9383_RS06420 (1276152) | 1276152..1277288 | - | 1137 | WP_000018658.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| M9383_RS06425 (1277373) | 1277373..1277876 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| M9383_RS06430 (1277949) | 1277949..1278641 | + | 693 | WP_000942537.1 | vancomycin high temperature exclusion protein | - |
| M9383_RS06435 (1278720) | 1278720..1279718 | + | 999 | WP_005050984.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T246279 WP_000550189.1 NZ_CP097828:c1275867-1275553 [Shigella flexneri]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT246279 WP_000560266.1 NZ_CP097828:c1275556-1275140 [Shigella flexneri]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|