Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 143357..143582 Replicon chromosome
Accession NZ_CP097828
Organism Shigella flexneri strain E

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag M9383_RS00890 Protein ID WP_000813254.1
Coordinates 143357..143512 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 143524..143582 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9383_RS00835 138669..139019 - 351 WP_005049241.1 IS66 family insertion sequence element accessory protein TnpB -
M9383_RS00840 139016..139690 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -
M9383_RS00845 139789..140004 - 216 WP_000839572.1 class II holin family protein -
M9383_RS00870 140800..141488 - 689 Protein_160 bacteriophage antitermination protein Q -
M9383_RS00875 141485..141850 - 366 WP_000140017.1 RusA family crossover junction endodeoxyribonuclease -
M9383_RS00880 141851..142909 - 1059 WP_001265248.1 DUF968 domain-containing protein -
M9383_RS00885 142911..143189 - 279 WP_011069426.1 hypothetical protein -
M9383_RS00890 143357..143512 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 143524..143582 + 59 - - Antitoxin
M9383_RS00895 144164..144580 - 417 WP_005069274.1 hypothetical protein -
M9383_RS00900 144607..144747 + 141 Protein_166 DUF4224 domain-containing protein -
M9383_RS00905 144747..145787 + 1041 WP_005096324.1 tyrosine-type recombinase/integrase -
M9383_RS00915 145998..146795 + 798 WP_024260703.1 DgsA anti-repressor MtfA -
M9383_RS00925 147133..148395 + 1263 Protein_169 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 108790..179013 70223


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T246277 WP_000813254.1 NZ_CP097828:c143512-143357 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT246277 NZ_CP097828:143524-143582 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References