Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 4006807..4007404 | Replicon | chromosome |
| Accession | NZ_CP097808 | ||
| Organism | Klebsiella variicola strain 17YN56 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0B7GEF2 |
| Locus tag | M9O80_RS19555 | Protein ID | WP_012542526.1 |
| Coordinates | 4007087..4007404 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9O80_RS19550 | Protein ID | WP_012542525.1 |
| Coordinates | 4006807..4007094 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O80_RS19520 (M9O80_19520) | 4002762..4003010 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
| M9O80_RS19525 (M9O80_19525) | 4003027..4003368 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M9O80_RS19530 (M9O80_19530) | 4003399..4004514 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
| M9O80_RS19535 (M9O80_19535) | 4004694..4005275 | + | 582 | WP_046881940.1 | TetR/AcrR family transcriptional regulator | - |
| M9O80_RS19540 (M9O80_19540) | 4005275..4005643 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
| M9O80_RS19545 (M9O80_19545) | 4005763..4006416 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M9O80_RS19550 (M9O80_19550) | 4006807..4007094 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M9O80_RS19555 (M9O80_19555) | 4007087..4007404 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9O80_RS19560 (M9O80_19560) | 4007589..4008632 | - | 1044 | WP_016160437.1 | DUF2157 domain-containing protein | - |
| M9O80_RS19565 (M9O80_19565) | 4009161..4010027 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
| M9O80_RS19570 (M9O80_19570) | 4010136..4011563 | + | 1428 | WP_117121081.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12092.35 Da Isoelectric Point: 11.2767
>T246271 WP_012542526.1 NZ_CP097808:c4007404-4007087 [Klebsiella variicola]
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
IFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|